PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_066300_hpks.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 748aa    MW: 82825.2 Da    PI: 5.7113
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_066300_hpks.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.9e-2053108156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r++ +++t++q++eLe++F+++ +p++++r e+ ++lgL+ rqVk+WFqNrR++ k
  Bv3_066300_hpks.t1  53 RKRYHRHTPQQIQELENFFKNCAHPDEKQRLEIGRRLGLESRQVKFWFQNRRTQLK 108
                         789999**********************************************9987 PP

2START168.73.8e-532594793204
                         HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         a +a++el+++a+ ++p+W+k      e +n +e+l+kf  s++       + ++a+r++g v+ ++ +lv +++  + +W+ +++    k
  Bv3_066300_hpks.t1 259 AMAAMDELLAMAQTDSPLWFKGLddgkELLNHEEYLKKF--SGFigmrpcgFITDASRETGSVFITSSELVDTMMFPR-RWQDMFPctisK 346
                         5689*******************9999999*********..55567**********************7777777766.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t+ev+ +g      g+lqlm+ae++++sp vp R   ++Ry++q+++g w++vdvSvd  ++p+ s s++++++lpSg+++++++ng+s
  Bv3_066300_hpks.t1 347 ATTVEVLFNGaggnrdGELQLMNAEFVFPSPFVPfRQEKILRYCKQHSEGMWAVVDVSVDMIREPSFSGSSIKSRRLPSGCIVQDVANGYS 437
                         *****************************************************************99************************ PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                          vtw+ehv+++++ +h+l+r+l++sg+a+ga++w+atlqr +
  Bv3_066300_hpks.t1 438 LVTWIEHVEYDENCIHQLYRPLLRSGMAFGAQRWLATLQRER 479
                         ***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-1935110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-1944112IPR009057Homeodomain-like
PROSITE profilePS5007117.28150110IPR001356Homeobox domain
SMARTSM003891.8E-1851114IPR001356Homeobox domain
CDDcd000863.10E-1852111No hitNo description
PfamPF000462.3E-1753108IPR001356Homeobox domain
SuperFamilySSF559612.33E-26247477No hitNo description
PROSITE profilePS5084838.129248484IPR002913START domain
SMARTSM002344.0E-37257481IPR002913START domain
PfamPF018529.0E-46259479IPR002913START domain
CDDcd088751.22E-94264477No hitNo description
SuperFamilySSF559617.0E-13502677No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MEGQEEMGFY GDQFDPNNII GREKEDSGSD NYDTVSVEDV PEGASQIKVK GRRKRYHRHT  60
PQQIQELENF FKNCAHPDEK QRLEIGRRLG LESRQVKFWF QNRRTQLKTQ MERHENVVLK  120
QEYDKLRIEN IAIKDAMRNP LCQSCGGPAM LGELSMDQHH LRVENSRLKD ELTRVCALAE  180
RFLGKPITDV VGPISLPGSN SSLELSMGRG GLSGFMSSPA SLPMGHNLEN GVSSNSTMTN  240
SMSGPVSTEY EKTMFMQAAM AAMDELLAMA QTDSPLWFKG LDDGKELLNH EEYLKKFSGF  300
IGMRPCGFIT DASRETGSVF ITSSELVDTM MFPRRWQDMF PCTISKATTV EVLFNGAGGN  360
RDGELQLMNA EFVFPSPFVP FRQEKILRYC KQHSEGMWAV VDVSVDMIRE PSFSGSSIKS  420
RRLPSGCIVQ DVANGYSLVT WIEHVEYDEN CIHQLYRPLL RSGMAFGAQR WLATLQRERD  480
CAAIFMSSRI FPEDTTVGAV TQEGRRSILK LMRRISNNFC SGLCASSACR WEKLQVGGLG  540
ADVCVMSRVS IDEPGEPSGV VLSASTSVWL PVTRQHLFDF LRDEKLRGKW DILANGGPME  600
VIARLSKSHD GNNCVALLCP PAAPARESNM LILQESWTDR TGSFIVYAPV DSTSMESVLR  660
GGDSDYLALL PSGFAIADAA ILPNALTLAN DNGDGGGTVG RGASALTLGF QILVNSLPTA  720
KLTVESINTV NDLMSCTIQK IRDSLGVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693469.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A0J8BGB90.0A0A0J8BGB9_BETVU; Uncharacterized protein
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein